PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR09G00910.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family MYB
Protein Properties Length: 273aa    MW: 29841.8 Da    PI: 10.3948
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR09G00910.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.31.5e-171459147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEd  l ++v ++G ++W++I++ ++ gR++k+c++rw + 
  LPERR09G00910.1 14 KGPWSPEEDTALQRLVGRHGARNWSLISKSIP-GRSGKSCRLRWCNQ 59
                     79******************************.***********985 PP

2Myb_DNA-binding54.13.7e-1768110347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++T+eEd+ +++a++++G++ W+tIar +  gRt++ +k++w++ 
  LPERR09G00910.1  68 PFTPEEDDTILRAHARFGNK-WATIARLLS-GRTDNAIKNHWNST 110
                      89******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.576964IPR017930Myb domain
SuperFamilySSF466891.2E-3111107IPR009057Homeodomain-like
SMARTSM007172.6E-151362IPR001005SANT/Myb domain
PfamPF002492.3E-171459IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.5E-251567IPR009057Homeodomain-like
CDDcd001674.32E-151658No hitNo description
SMARTSM007171.7E-1465113IPR001005SANT/Myb domain
PROSITE profilePS5129420.65566115IPR017930Myb domain
CDDcd001675.54E-1268111No hitNo description
Gene3DG3DSA:1.10.10.601.4E-2368114IPR009057Homeodomain-like
PfamPF002491.2E-1468110IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MACRRGGGEV DRIKGPWSPE EDTALQRLVG RHGARNWSLI SKSIPGRSGK SCRLRWCNQL  60
SPQVEHRPFT PEEDDTILRA HARFGNKWAT IARLLSGRTD NAIKNHWNST LKRKHTNSSD  120
DDHLLLPRPL KRTTSSGSPS GSDLSDSSHH SLPSHMPSSP PHQLLYRPLA RAGGVVVPPP  180
PATSLSLSLS LPGLDHQQPQ PDPSPSESAV PLPTTPASQM PPPPPFSAEF LAMMQEMIRI  240
EVRNYMSGSG VDPRSPPDAV RAASRIMGMA KIE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-38111144107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00274DAPTransfer from AT2G23290Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126171e-140CP012617.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 9 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015612590.11e-118PREDICTED: transcription factor MYB44
SwissprotQ9FDW13e-77MYB44_ARATH; Transcription factor MYB44
TrEMBLA0A0D9XBE30.0A0A0D9XBE3_9ORYZ; Uncharacterized protein
STRINGORGLA09G0002900.11e-118(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP78938154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.16e-65myb domain protein 73